Lineage for d1g6rh2 (1g6r H:1-181)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719393Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)
  7. 719653Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (40 PDB entries)
  8. 719706Domain d1g6rh2: 1g6r H:1-181 [38295]
    Other proteins in same PDB: d1g6ra1, d1g6ra2, d1g6rb1, d1g6rb2, d1g6rc1, d1g6rc2, d1g6rd1, d1g6rd2, d1g6rh1, d1g6ri1, d1g6rl_, d1g6rm_

Details for d1g6rh2

PDB Entry: 1g6r (more details), 2.8 Å

PDB Description: a functional hot spot for antigen recognition in a superagonist tcr/mhc complex
PDB Compounds: (H:) major histocompatibility complex class I molecule

SCOP Domain Sequences for d1g6rh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g6rh2 d.19.1.1 (H:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

SCOP Domain Coordinates for d1g6rh2:

Click to download the PDB-style file with coordinates for d1g6rh2.
(The format of our PDB-style files is described here.)

Timeline for d1g6rh2: