Lineage for d1g6rh2 (1g6r H:1-181)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) 
Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins) Protein MHC class I, alpha-1 and alpha-2 domains [54468] (18 species) 
Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (15 PDB entries) 
Domain d1g6rh2: 1g6r H:1-181 [38295]
Other proteins in same PDB: d1g6ra1, d1g6ra2, d1g6rb1, d1g6rb2, d1g6rc1, d1g6rc2, d1g6rd1, d1g6rd2, d1g6rh1, d1g6ri1, d1g6rl1, d1g6rm1
Details for d1g6rh2
PDB Entry: 1g6r (more details), 2.8 Å
PDB Description: a functional hot spot for antigen recognition in a superagonist tcr/mhc complex
SCOP Domain Sequences for d1g6rh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g6rh2 d.19.1.1 (H:1-181) MHC class I, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r
SCOP Domain Coordinates for d1g6rh2:
Click to download the PDB-style file with coordinates for d1g6rh2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g6rh2:
View in 3D
