SCOPe 2.08: Domain d6w34b_: 6w34 B:

Lineage for d6w34b_ (6w34 B:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Bacillus cereus [TaxId:226900] [382896] (2 PDB entries)

8. Domain d6w34b_: 6w34 B: [382939]
   automated match to d1dy6a_
   complexed with cl, edo, so4

Details for d6w34b_

PDB Entry: 6w34, 1.45 Å

PDB Description: crystal structure of class a beta-lactamase from bacillus cereus

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d6w34b_:

Sequence; same for both SEQRES and ATOM records:

>d6w34b_ e.3.1.0 (B:) automated matches {Bacillus cereus [TaxId: 226900]}
nqathkefsqlekkfdarlgvyaidtgtnqtisyrsnerfafastykalaagvllqqnsi
dslnevitytkedlvdyspvtekhvdtgmklgeiaeaavrssdntagnilfnkiggpkgy
ekalrhmgdritmsdrfetelneaipgdirdtstakaiatnlkaftvgnalpaekrkilt
ewmkgnatgdkliragvptdwvvgdksgagsygtrndiaivwppnrtpiiiailsskdek
eatydnqliaeatevivkal

Timeline for d6w34b_:

• d6w34b_ first appeared in SCOPe 2.07