Lineage for d6y2dd1 (6y2d D:185-256)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947085Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 2947086Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2947194Family d.51.1.0: automated matches [227159] (1 protein)
    not a true family
  6. 2947195Protein automated matches [226866] (4 species)
    not a true protein
  7. 2947196Species Human (Homo sapiens) [TaxId:9606] [225002] (11 PDB entries)
  8. 2947204Domain d6y2dd1: 6y2d D:185-256 [382923]
    Other proteins in same PDB: d6y2da2, d6y2db2, d6y2dd2
    automated match to d4lija_
    complexed with gol, so4

Details for d6y2dd1

PDB Entry: 6y2d (more details), 1.9 Å

PDB Description: crystal structure of the second kh domain of fubp1
PDB Compounds: (D:) Far upstream element-binding protein 1

SCOPe Domain Sequences for d6y2dd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6y2dd1 d.51.1.0 (D:185-256) automated matches {Human (Homo sapiens) [TaxId: 9606]}
navqeimipaskaglvigkggetikqlqeragvkmvmiqdgpqntgadkplritgdpykv
qqakemvlelir

SCOPe Domain Coordinates for d6y2dd1:

Click to download the PDB-style file with coordinates for d6y2dd1.
(The format of our PDB-style files is described here.)

Timeline for d6y2dd1: