SCOPe 2.07: Domain d2mhac2: 2mha C:1-181

Lineage for d2mhac2 (2mha C:1-181)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (52 PDB entries)
   Uniprot P01901 22-299

8. Domain d2mhac2: 2mha C:1-181 [38292]
   Other proteins in same PDB: d2mhaa1, d2mhab_, d2mhac1, d2mhad_

Details for d2mhac2

PDB Entry: 2mha, 2.5 Å

PDB Description: crystal structure of the major histocompatibility complex class i h- 2kb molecule containing a single viral peptide: implications for peptide binding and t-cell receptor recognition

PDB Compounds: (C:) class I histocompatibility antigen (h-2kb) (alpha chain)

SCOPe Domain Sequences for d2mhac2:

Sequence; same for both SEQRES and ATOM records:

>d2mhac2 d.19.1.1 (C:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

Timeline for d2mhac2:

• d2mhac2 first appeared (with stable ids) in SCOP 1.55
  
• d2mhac2 appears in SCOPe 2.06
  
• d2mhac2 appears in the current release, SCOPe 2.08