Lineage for d2mhac2 (2mha C:1-181)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 78647Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 78648Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 78649Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 78661Protein MHC class I, alpha-1 and alpha-2 domains [54468] (18 species)
  7. 78755Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (15 PDB entries)
  8. 78770Domain d2mhac2: 2mha C:1-181 [38292]
    Other proteins in same PDB: d2mhaa1, d2mhab1, d2mhac1, d2mhad1

Details for d2mhac2

PDB Entry: 2mha (more details), 2.8 Å

PDB Description: crystal structure of the major histocompatibility complex class i h- 2kb molecule containing a single viral peptide: implications for peptide binding and t-cell receptor recognition
PDB Compounds: (C:)

SCOP Domain Sequences for d2mhac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mhac2 d.19.1.1 (C:1-181) MHC class I, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

SCOP Domain Coordinates for d2mhac2:

Click to download the PDB-style file with coordinates for d2mhac2.
(The format of our PDB-style files is described here.)

Timeline for d2mhac2: