SCOP 1.65: Domain d2mhaa2: 2mha A:1-181

Lineage for d2mhaa2 (2mha A:1-181)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (19 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (27 PDB entries)

8. Domain d2mhaa2: 2mha A:1-181 [38291]
   Other proteins in same PDB: d2mhaa1, d2mhab_, d2mhac1, d2mhad_

Details for d2mhaa2

PDB Entry: 2mha, 2.8 Å

PDB Description: crystal structure of the major histocompatibility complex class i h- 2kb molecule containing a single viral peptide: implications for peptide binding and t-cell receptor recognition

SCOP Domain Sequences for d2mhaa2:

Sequence; same for both SEQRES and ATOM records:

>d2mhaa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

Timeline for d2mhaa2:

• d2mhaa2 first appeared (with stable ids) in SCOP 1.55
  
• d2mhaa2 appears in SCOP 1.63
  
• d2mhaa2 appears in SCOP 1.67
  
• d2mhaa2 appears in the current release, SCOPe 2.08