Lineage for d2mhaa2 (2mha A:1-181)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190293Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 190294Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 190295Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 190321Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species)
  7. 190425Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (22 PDB entries)
  8. 190449Domain d2mhaa2: 2mha A:1-181 [38291]
    Other proteins in same PDB: d2mhaa1, d2mhab1, d2mhac1, d2mhad1

Details for d2mhaa2

PDB Entry: 2mha (more details), 2.8 Å

PDB Description: crystal structure of the major histocompatibility complex class i h- 2kb molecule containing a single viral peptide: implications for peptide binding and t-cell receptor recognition

SCOP Domain Sequences for d2mhaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mhaa2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

SCOP Domain Coordinates for d2mhaa2:

Click to download the PDB-style file with coordinates for d2mhaa2.
(The format of our PDB-style files is described here.)

Timeline for d2mhaa2: