Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily) beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta |
Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
Family d.51.1.0: automated matches [227159] (1 protein) not a true family |
Protein automated matches [226866] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225002] (11 PDB entries) |
Domain d6y2da1: 6y2d A:185-257 [382905] Other proteins in same PDB: d6y2da2, d6y2db2, d6y2dd2 automated match to d4lija_ complexed with gol, so4 |
PDB Entry: 6y2d (more details), 1.9 Å
SCOPe Domain Sequences for d6y2da1:
Sequence, based on SEQRES records: (download)
>d6y2da1 d.51.1.0 (A:185-257) automated matches {Human (Homo sapiens) [TaxId: 9606]} navqeimipaskaglvigkggetikqlqeragvkmvmiqdgpqntgadkplritgdpykv qqakemvlelird
>d6y2da1 d.51.1.0 (A:185-257) automated matches {Human (Homo sapiens) [TaxId: 9606]} navqeimipaskaglvigkggetikqlqeragvkmvmiadkplritgdpykvqqakemvl elird
Timeline for d6y2da1: