SCOPe 2.01: Domain d1bqhd2: 1bqh D:1-181

Lineage for d1bqhd2 (1bqh D:1-181)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (40 PDB entries)
   Uniprot P01901 22-299

8. Domain d1bqhd2: 1bqh D:1-181 [38290]
   Other proteins in same PDB: d1bqha1, d1bqhb_, d1bqhd1, d1bqhe_, d1bqhg_, d1bqhh_, d1bqhi_, d1bqhk_
   complexed with nag, ndg

Details for d1bqhd2

PDB Entry: 1bqh, 2.8 Å

PDB Description: murine cd8aa ectodomain fragment in complex with h-2kb/vsv8

PDB Compounds: (D:) protein (h-2 class I histocompatibility antigen)

SCOPe Domain Sequences for d1bqhd2:

Sequence; same for both SEQRES and ATOM records:

>d1bqhd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

Timeline for d1bqhd2:

• d1bqhd2 first appeared (with stable ids) in SCOP 1.55
  
• d1bqhd2 appears in SCOP 1.75
  
• d1bqhd2 appears in SCOPe 2.02
  
• d1bqhd2 appears in the current release, SCOPe 2.08