Lineage for d1bqhd2 (1bqh D:1-181)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1020838Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1020839Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1020840Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1020887Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1021201Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (40 PDB entries)
    Uniprot P01901 22-299
  8. 1021241Domain d1bqhd2: 1bqh D:1-181 [38290]
    Other proteins in same PDB: d1bqha1, d1bqhb_, d1bqhd1, d1bqhe_, d1bqhg_, d1bqhh_, d1bqhi_, d1bqhk_
    complexed with nag, ndg

Details for d1bqhd2

PDB Entry: 1bqh (more details), 2.8 Å

PDB Description: murine cd8aa ectodomain fragment in complex with h-2kb/vsv8
PDB Compounds: (D:) protein (h-2 class I histocompatibility antigen)

SCOPe Domain Sequences for d1bqhd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqhd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

SCOPe Domain Coordinates for d1bqhd2:

Click to download the PDB-style file with coordinates for d1bqhd2.
(The format of our PDB-style files is described here.)

Timeline for d1bqhd2: