Lineage for d1bqha2 (1bqh A:1-181)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 409342Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 409343Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 409344Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
  6. 409372Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (20 species)
  7. 409523Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (34 PDB entries)
  8. 409552Domain d1bqha2: 1bqh A:1-181 [38289]
    Other proteins in same PDB: d1bqha1, d1bqhb_, d1bqhd1, d1bqhe_, d1bqhg_, d1bqhh_, d1bqhi_, d1bqhk_

Details for d1bqha2

PDB Entry: 1bqh (more details), 2.8 Å

PDB Description: murine cd8aa ectodomain fragment in complex with h-2kb/vsv8

SCOP Domain Sequences for d1bqha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqha2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

SCOP Domain Coordinates for d1bqha2:

Click to download the PDB-style file with coordinates for d1bqha2.
(The format of our PDB-style files is described here.)

Timeline for d1bqha2: