SCOP 1.61: Domain d1fo0h2: 1fo0 H:0-181

Lineage for d1fo0h2 (1fo0 H:0-181)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)

6. Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (22 PDB entries)

8. Domain d1fo0h2: 1fo0 H:0-181 [38288]
   Other proteins in same PDB: d1fo0a_, d1fo0b_, d1fo0h1, d1fo0l1

Details for d1fo0h2

PDB Entry: 1fo0, 2.5 Å

PDB Description: murine alloreactive scfv tcr-peptide-mhc class i molecule complex

SCOP Domain Sequences for d1fo0h2:

Sequence; same for both SEQRES and ATOM records:

>d1fo0h2 d.19.1.1 (H:0-181) MHC class I, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB}
mgphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpey
weretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyayd
gcdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatl
lr

Timeline for d1fo0h2:

• d1fo0h2 first appeared (with stable ids) in SCOP 1.55
  
• d1fo0h2 appears in SCOP 1.59
  
• d1fo0h2 appears in SCOP 1.63
  
• d1fo0h2 appears in the current release, SCOPe 2.08