Lineage for d1fo0h2 (1fo0 H:0-181)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 78647Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 78648Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 78649Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 78661Protein MHC class I, alpha-1 and alpha-2 domains [54468] (18 species)
  7. 78755Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (15 PDB entries)
  8. 78766Domain d1fo0h2: 1fo0 H:0-181 [38288]
    Other proteins in same PDB: d1fo0a_, d1fo0b_, d1fo0h1, d1fo0l1

Details for d1fo0h2

PDB Entry: 1fo0 (more details), 2.5 Å

PDB Description: murine alloreactive scfv tcr-peptide-mhc class i molecule complex

SCOP Domain Sequences for d1fo0h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fo0h2 d.19.1.1 (H:0-181) MHC class I, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB}
mgphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpey
weretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyayd
gcdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatl
lr

SCOP Domain Coordinates for d1fo0h2:

Click to download the PDB-style file with coordinates for d1fo0h2.
(The format of our PDB-style files is described here.)

Timeline for d1fo0h2: