Lineage for d6tdpa1 (6tdp A:1-181)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2506505Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2506604Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2506616Species Human (Homo sapiens), HLA-A2 [TaxId:9606] [54469] (9 PDB entries)
  8. 3082781Domain d6tdpa1: 6tdp A:1-181 [382843]
    Other proteins in same PDB: d6tdpa2, d6tdpb_
    automated match to d4l29a1
    complexed with gly, gol, leu, na

Details for d6tdpa1

PDB Entry: 6tdp (more details), 1.4 Å

PDB Description: crystal structure of the disulfide engineered hla-a0201 molecule in complex with one gl dipeptide in the a pocket.
PDB Compounds: (A:) MHC class I antigen

SCOPe Domain Sequences for d6tdpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tdpa1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgcynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmcaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d6tdpa1:

Click to download the PDB-style file with coordinates for d6tdpa1.
(The format of our PDB-style files is described here.)

Timeline for d6tdpa1:

  • d6tdpa1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6tdpa2
View in 3D
Domains from other chains:
(mouse over for more information)
d6tdpb_