Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.177: FAH [56528] (1 superfamily) unusual fold; contains 3 layers of beta-sheet structure |
Superfamily d.177.1: FAH [56529] (2 families) |
Family d.177.1.1: FAH [56530] (7 proteins) automatically mapped to Pfam PF01557 |
Protein automated matches [191123] (4 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [381497] (2 PDB entries) |
Domain d6sbib_: 6sbi B: [382840] automated match to d1sawb_ complexed with cl, k, mg, oxl |
PDB Entry: 6sbi (more details), 2.7 Å
SCOPe Domain Sequences for d6sbib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6sbib_ d.177.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} tkplsrfwewgknivcvgrnyadhvkemrstvlsepvlflkpstayapegspvlmpaycr nlhhevelgvllgkrgeaipeaaamdyvagyalcldmtardvqeeckkkglpwtlaksft sscpvsafvpkekipdphalrlwlkvngelrqegktssmifsipyiisyvskiitleegd liltgtpkgvgpikendeieagidgvvsmrfkvkrs
Timeline for d6sbib_: