Lineage for d1vada2 (1vad A:1-181)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2182691Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2183117Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (47 PDB entries)
    Uniprot P01901 22-299
  8. 2183142Domain d1vada2: 1vad A:1-181 [38284]
    Other proteins in same PDB: d1vada1, d1vadb_

Details for d1vada2

PDB Entry: 1vad (more details), 2.5 Å

PDB Description: mhc class i h-2kb heavy chain complexed with beta-2 microglobulin and yeast alpha-glucosidase
PDB Compounds: (A:) MHC class I h-2kb heavy chain

SCOPe Domain Sequences for d1vada2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vada2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

SCOPe Domain Coordinates for d1vada2:

Click to download the PDB-style file with coordinates for d1vada2.
(The format of our PDB-style files is described here.)

Timeline for d1vada2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vada1
View in 3D
Domains from other chains:
(mouse over for more information)
d1vadb_