Lineage for d2vaba2 (2vab A:1-181)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719393Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)
  7. 719653Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (40 PDB entries)
  8. 719675Domain d2vaba2: 2vab A:1-181 [38283]
    Other proteins in same PDB: d2vaba1, d2vabb_

Details for d2vaba2

PDB Entry: 2vab (more details), 2.5 Å

PDB Description: mhc class i h-2kb heavy chain complexed with beta-2 microglobulin and sendai virus nucleoprotein
PDB Compounds: (A:) MHC class I h-2kb heavy chain

SCOP Domain Sequences for d2vaba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vaba2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

SCOP Domain Coordinates for d2vaba2:

Click to download the PDB-style file with coordinates for d2vaba2.
(The format of our PDB-style files is described here.)

Timeline for d2vaba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vaba1
View in 3D
Domains from other chains:
(mouse over for more information)
d2vabb_