| Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins) |
| Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species) |
| Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (23 PDB entries) |
| Domain d2vaba2: 2vab A:1-181 [38283] Other proteins in same PDB: d2vaba1, d2vabb_ |
PDB Entry: 2vab (more details), 2.5 Å
SCOP Domain Sequences for d2vaba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vaba2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r
Timeline for d2vaba2: