Lineage for d2vaaa2 (2vaa A:1-181)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255210Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 255211Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 255212Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 255238Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species)
  7. 255359Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (23 PDB entries)
  8. 255368Domain d2vaaa2: 2vaa A:1-181 [38282]
    Other proteins in same PDB: d2vaaa1, d2vaab_

Details for d2vaaa2

PDB Entry: 2vaa (more details), 2.3 Å

PDB Description: mhc class i h-2kb heavy chain complexed with beta-2 microglobulin and vesicular stomatitis virus nucleoprotein

SCOP Domain Sequences for d2vaaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vaaa2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

SCOP Domain Coordinates for d2vaaa2:

Click to download the PDB-style file with coordinates for d2vaaa2.
(The format of our PDB-style files is described here.)

Timeline for d2vaaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vaaa1
View in 3D
Domains from other chains:
(mouse over for more information)
d2vaab_