Lineage for d6tdrc2 (6tdr C:182-275)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (28 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1489 PDB entries)
  8. 3082751Domain d6tdrc2: 6tdr C:182-275 [382813]
    Other proteins in same PDB: d6tdra1, d6tdrb1, d6tdrb2, d6tdrc1, d6tdrd1, d6tdrd2
    automated match to d1ogaa1
    complexed with edo, na

Details for d6tdrc2

PDB Entry: 6tdr (more details), 1.75 Å

PDB Description: crystal structure of the disulfide engineered hla-a0201 molecule devoid of peptide (annealed)
PDB Compounds: (C:) MHC class I antigen

SCOPe Domain Sequences for d6tdrc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tdrc2 b.1.1.0 (C:182-275) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwvavvvpsgqeqrytchvqheglpkpltlrwe

SCOPe Domain Coordinates for d6tdrc2:

Click to download the PDB-style file with coordinates for d6tdrc2.
(The format of our PDB-style files is described here.)

Timeline for d6tdrc2:

  • d6tdrc2 is new in SCOPe 2.07-stable