SCOPe 2.02: Domain d1a6zc2: 1a6z C:4-181

Lineage for d1a6zc2 (1a6z C:4-181)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Hemochromatosis protein Hfe, alpha-1 and alpha-2 domains [88832] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54480] (2 PDB entries)

8. Domain d1a6zc2: 1a6z C:4-181 [38281]
   Other proteins in same PDB: d1a6za1, d1a6zb_, d1a6zc1, d1a6zd_

Details for d1a6zc2

PDB Entry: 1a6z, 2.6 Å

PDB Description: hfe (human) hemochromatosis protein

PDB Compounds: (C:) hfe

SCOPe Domain Sequences for d1a6zc2:

Sequence; same for both SEQRES and ATOM records:

>d1a6zc2 d.19.1.1 (C:4-181) Hemochromatosis protein Hfe, alpha-1 and alpha-2 domains {Human (Homo sapiens) [TaxId: 9606]}
rshslhylfmgaseqdlglslfealgyvddqlfvfydhesrrveprtpwvssrissqmwl
qlsqslkgwdhmftvdfwtimenhnhskeshtlqvilgcemqednstegywkygydgqdh
lefcpdtldwraaeprawptklewerhkirarqnraylerdcpaqlqqllelgrgvld

Timeline for d1a6zc2:

• d1a6zc2 first appeared (with stable ids) in SCOP 1.55
  
• d1a6zc2 appears in SCOPe 2.01
  
• d1a6zc2 appears in SCOPe 2.03
  
• d1a6zc2 appears in the current release, SCOPe 2.08