Lineage for d1de4g2 (1de4 G:4-181)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501112Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 501113Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 501114Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 501572Protein Hemochromatosis protein Hfe, alpha-1 and alpha-2 domains [88832] (1 species)
  7. 501573Species Human (Homo sapiens) [TaxId:9606] [54480] (2 PDB entries)
  8. 501576Domain d1de4g2: 1de4 G:4-181 [38279]
    Other proteins in same PDB: d1de4a1, d1de4b_, d1de4c1, d1de4c2, d1de4c3, d1de4d1, d1de4e_, d1de4f1, d1de4f2, d1de4f3, d1de4g1, d1de4h_, d1de4i1, d1de4i2, d1de4i3

Details for d1de4g2

PDB Entry: 1de4 (more details), 2.8 Å

PDB Description: hemochromatosis protein hfe complexed with transferrin receptor

SCOP Domain Sequences for d1de4g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1de4g2 d.19.1.1 (G:4-181) Hemochromatosis protein Hfe, alpha-1 and alpha-2 domains {Human (Homo sapiens)}
rshslhylfmgaseqdlglslfealgyvddqlfvfydhesrrveprtpwvssrissqmwl
qlsqslkgwdhmftvdfwtimenhnhskeshtlqvilgcemqednstegywkygydgqdh
lefcpdtldwraaeprawptklewerhkirarqnraylerdcpaqlqqllelgrgvld

SCOP Domain Coordinates for d1de4g2:

Click to download the PDB-style file with coordinates for d1de4g2.
(The format of our PDB-style files is described here.)

Timeline for d1de4g2: