Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.19: HydA/Nqo6-like [56769] (1 superfamily) 2 domains: (1) alpa/beta; (2) Fe-S cluster-bound |
Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) |
Family e.19.1.0: automated matches [191636] (1 protein) not a true family |
Protein automated matches [191172] (11 species) not a true protein |
Species Escherichia coli [TaxId:83333] [351202] (9 PDB entries) |
Domain d6rp2t_: 6rp2 T: [382788] Other proteins in same PDB: d6rp2l_, d6rp2m_ automated match to d3rgws_ complexed with cl, f3s, fco, li, lmt, mg, ni, sf3, sf4, so4 |
PDB Entry: 6rp2 (more details), 1.35 Å
SCOPe Domain Sequences for d6rp2t_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rp2t_ e.19.1.0 (T:) automated matches {Escherichia coli [TaxId: 83333]} kpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedi itqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqa arpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfyg qrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpctynacsstrwndgvsfpi qsghgclgcaengfwdrgsfysrv
Timeline for d6rp2t_: