Lineage for d6tdoa2 (6tdo A:182-274)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (28 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1489 PDB entries)
  8. 3082722Domain d6tdoa2: 6tdo A:182-274 [382784]
    Other proteins in same PDB: d6tdoa1, d6tdob_
    automated match to d1ogaa1
    complexed with gly, gol, met

Details for d6tdoa2

PDB Entry: 6tdo (more details), 1.65 Å

PDB Description: crystal structure of the disulfide engineered hla-a0201 molecule in complex with one gm dipeptide in the a pocket.
PDB Compounds: (A:) MHC class I antigen

SCOPe Domain Sequences for d6tdoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tdoa2 b.1.1.0 (A:182-274) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwvavvvpsgqeqrytchvqheglpkpltlrw

SCOPe Domain Coordinates for d6tdoa2:

Click to download the PDB-style file with coordinates for d6tdoa2.
(The format of our PDB-style files is described here.)

Timeline for d6tdoa2:

  • d6tdoa2 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6tdoa1
View in 3D
Domains from other chains:
(mouse over for more information)
d6tdob_