Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins) |
Protein Hemochromatosis protein Hfe, alpha-1 and alpha-2 domains [88832] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54480] (2 PDB entries) |
Domain d1de4d2: 1de4 D:4-181 [38278] Other proteins in same PDB: d1de4a1, d1de4b_, d1de4c1, d1de4c2, d1de4c3, d1de4d1, d1de4e_, d1de4f1, d1de4f2, d1de4f3, d1de4g1, d1de4h_, d1de4i1, d1de4i2, d1de4i3 |
PDB Entry: 1de4 (more details), 2.8 Å
SCOP Domain Sequences for d1de4d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1de4d2 d.19.1.1 (D:4-181) Hemochromatosis protein Hfe, alpha-1 and alpha-2 domains {Human (Homo sapiens)} rshslhylfmgaseqdlglslfealgyvddqlfvfydhesrrveprtpwvssrissqmwl qlsqslkgwdhmftvdfwtimenhnhskeshtlqvilgcemqednstegywkygydgqdh lefcpdtldwraaeprawptklewerhkirarqnraylerdcpaqlqqllelgrgvld
Timeline for d1de4d2: