Lineage for d1de4a2 (1de4 A:4-181)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1020838Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1020839Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1020840Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1021556Protein Hemochromatosis protein Hfe, alpha-1 and alpha-2 domains [88832] (1 species)
  7. 1021557Species Human (Homo sapiens) [TaxId:9606] [54480] (2 PDB entries)
  8. 1021558Domain d1de4a2: 1de4 A:4-181 [38277]
    Other proteins in same PDB: d1de4a1, d1de4b_, d1de4c1, d1de4c2, d1de4c3, d1de4d1, d1de4e_, d1de4f1, d1de4f2, d1de4f3, d1de4g1, d1de4h_, d1de4i1, d1de4i2, d1de4i3
    complexed with ca, gol, nag

Details for d1de4a2

PDB Entry: 1de4 (more details), 2.8 Å

PDB Description: hemochromatosis protein hfe complexed with transferrin receptor
PDB Compounds: (A:) hemochromatosis protein

SCOPe Domain Sequences for d1de4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1de4a2 d.19.1.1 (A:4-181) Hemochromatosis protein Hfe, alpha-1 and alpha-2 domains {Human (Homo sapiens) [TaxId: 9606]}
rshslhylfmgaseqdlglslfealgyvddqlfvfydhesrrveprtpwvssrissqmwl
qlsqslkgwdhmftvdfwtimenhnhskeshtlqvilgcemqednstegywkygydgqdh
lefcpdtldwraaeprawptklewerhkirarqnraylerdcpaqlqqllelgrgvld

SCOPe Domain Coordinates for d1de4a2:

Click to download the PDB-style file with coordinates for d1de4a2.
(The format of our PDB-style files is described here.)

Timeline for d1de4a2: