SCOPe 2.01: Domain d1mhec2: 1mhe C:2-181

Lineage for d1mhec2 (1mhe C:2-181)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)

7. Species Human (Homo sapiens), HLA-E [TaxId:9606] [54479] (8 PDB entries)

8. Domain d1mhec2: 1mhe C:2-181 [38276]
   Other proteins in same PDB: d1mhea1, d1mheb_, d1mhec1, d1mhed_
   complexed with so4

Details for d1mhec2

PDB Entry: 1mhe, 2.85 Å

PDB Description: the human non-classical major histocompatibility complex molecule hla-e

PDB Compounds: (C:) hla class I histocompatibility antigen hla-e

SCOPe Domain Sequences for d1mhec2:

Sequence; same for both SEQRES and ATOM records:

>d1mhec2 d.19.1.1 (C:2-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-E [TaxId: 9606]}
shslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseywd
retrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdrrflrgyeqfaydgk
dyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketllh

Timeline for d1mhec2:

• d1mhec2 first appeared (with stable ids) in SCOP 1.55
  
• d1mhec2 appears in SCOP 1.75
  
• d1mhec2 appears in SCOPe 2.02
  
• d1mhec2 appears in the current release, SCOPe 2.08