Lineage for d1mhec2 (1mhe C:2-181)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719393Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)
  7. 719581Species Human (Homo sapiens), HLA-E [TaxId:9606] [54479] (4 PDB entries)
  8. 719584Domain d1mhec2: 1mhe C:2-181 [38276]
    Other proteins in same PDB: d1mhea1, d1mheb_, d1mhec1, d1mhed_
    complexed with so4

Details for d1mhec2

PDB Entry: 1mhe (more details), 2.85 Å

PDB Description: the human non-classical major histocompatibility complex molecule hla-e
PDB Compounds: (C:) hla class I histocompatibility antigen hla-e

SCOP Domain Sequences for d1mhec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhec2 d.19.1.1 (C:2-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-E [TaxId: 9606]}
shslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseywd
retrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdrrflrgyeqfaydgk
dyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketllh

SCOP Domain Coordinates for d1mhec2:

Click to download the PDB-style file with coordinates for d1mhec2.
(The format of our PDB-style files is described here.)

Timeline for d1mhec2: