Lineage for d1mhec2 (1mhe C:2-181)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190293Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 190294Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 190295Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 190321Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species)
  7. 190405Species Human (Homo sapiens), HLA-E [TaxId:9606] [54479] (1 PDB entry)
  8. 190407Domain d1mhec2: 1mhe C:2-181 [38276]
    Other proteins in same PDB: d1mhea1, d1mheb1, d1mhec1, d1mhed1

Details for d1mhec2

PDB Entry: 1mhe (more details), 2.85 Å

PDB Description: the human non-classical major histocompatibility complex molecule hla-e

SCOP Domain Sequences for d1mhec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhec2 d.19.1.1 (C:2-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-E}
shslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseywd
retrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdrrflrgyeqfaydgk
dyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketllh

SCOP Domain Coordinates for d1mhec2:

Click to download the PDB-style file with coordinates for d1mhec2.
(The format of our PDB-style files is described here.)

Timeline for d1mhec2: