Lineage for d6sbic_ (6sbi C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3004667Fold d.177: FAH [56528] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure
  4. 3004668Superfamily d.177.1: FAH [56529] (2 families) (S)
  5. 3004669Family d.177.1.1: FAH [56530] (7 proteins)
    automatically mapped to Pfam PF01557
  6. 3004725Protein automated matches [191123] (4 species)
    not a true protein
  7. 3004758Species Mouse (Mus musculus) [TaxId:10090] [381497] (2 PDB entries)
  8. 3004765Domain d6sbic_: 6sbi C: [382752]
    automated match to d1sawb_
    complexed with cl, k, mg, oxl

Details for d6sbic_

PDB Entry: 6sbi (more details), 2.7 Å

PDB Description: x-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate
PDB Compounds: (C:) Acylpyruvase FAHD1, mitochondrial

SCOPe Domain Sequences for d6sbic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sbic_ d.177.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
plsrfwewgknivcvgrnyadhvkemrstvlsepvlflkpstayapegspvlmpaycrnl
hhevelgvllgkrgeaipeaaamdyvagyalcldmtardvqeeckkkglpwtlaksftss
cpvsafvpkekipdphalrlwlkvngelrqegktssmifsipyiisyvskiitleegdli
ltgtpkgvgpikendeieagidgvvsmrfkvkrs

SCOPe Domain Coordinates for d6sbic_:

Click to download the PDB-style file with coordinates for d6sbic_.
(The format of our PDB-style files is described here.)

Timeline for d6sbic_: