Lineage for d1mhea2 (1mhe A:2-181)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2506505Family d.19.1.1: MHC antigen-recognition domain [54453] (13 protein domains)
  6. 2506604Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 2506901Species Human (Homo sapiens), HLA-E [TaxId:9606] [54479] (8 PDB entries)
  8. 2506909Domain d1mhea2: 1mhe A:2-181 [38275]
    Other proteins in same PDB: d1mhea1, d1mheb_, d1mhec1, d1mhed_
    complexed with so4

Details for d1mhea2

PDB Entry: 1mhe (more details), 2.85 Å

PDB Description: the human non-classical major histocompatibility complex molecule hla-e
PDB Compounds: (A:) hla class I histocompatibility antigen hla-e

SCOPe Domain Sequences for d1mhea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhea2 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-E [TaxId: 9606]}
shslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseywd
retrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdrrflrgyeqfaydgk
dyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketllh

SCOPe Domain Coordinates for d1mhea2:

Click to download the PDB-style file with coordinates for d1mhea2.
(The format of our PDB-style files is described here.)

Timeline for d1mhea2: