SCOPe 2.07: Domain d6qv9a1: 6qv9 A:2-91

Lineage for d6qv9a1 (6qv9 A:2-91)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (38 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [346685] (6 PDB entries)

8. Domain d6qv9a1: 6qv9 A:2-91 [382745]
   Other proteins in same PDB: d6qv9a2, d6qv9b2
   automated match to d2rcva1
   complexed with mn; mutant

Details for d6qv9a1

PDB Entry: 6qv9, 1.8 Å

PDB Description: staphylococcus aureus superoxide dismutase soda double mutant

PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d6qv9a1:

Sequence; same for both SEQRES and ATOM records:

>d6qv9a1 a.2.11.0 (A:2-91) automated matches {Staphylococcus aureus [TaxId: 1280]}
afelpklpyafdalephfdketmeihhdrhhntyvtklnaavegtdlesksieeivanld
svpaniqtavrnnggghlnhslfwellspn

Timeline for d6qv9a1:

• d6qv9a1 is new in SCOPe 2.07-stable
  
• d6qv9a1 appears in the current release, SCOPe 2.08