SCOPe 2.08: Domain d6jkac1: 6jka C:6-228

Lineage for d6jkac1 (6jka C:6-228)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein automated matches [190079] (12 species)
   not a true protein

7. Species Serratia marcescens [TaxId:615] [186800] (10 PDB entries)

8. Domain d6jkac1: 6jka C:6-228 [382742]
   Other proteins in same PDB: d6jkaa2, d6jkac2
   automated match to d5ev8c_
   complexed with bqu, bs0, zn

Details for d6jkac1

PDB Entry: 6jka, 2.01 Å

PDB Description: crystal structure of metallo-beta-lactamse, imp-1, in complex with a thiazole-bearing inhibitor

PDB Compounds: (C:) Metallo-beta-lactamase type 2

SCOPe Domain Sequences for d6jkac1:

Sequence; same for both SEQRES and ATOM records:

>d6jkac1 d.157.1.1 (C:6-228) automated matches {Serratia marcescens [TaxId: 615]}
eslpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvt
wfvergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgv
nywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksak
llkskygkaklvvpshsevgdasllkltleqavkglneskkps

Timeline for d6jkac1:

• d6jkac1 first appeared in SCOPe 2.07