Lineage for d6jkac1 (6jka C:6-228)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996833Protein automated matches [190079] (12 species)
    not a true protein
  7. 2997029Species Serratia marcescens [TaxId:615] [186800] (10 PDB entries)
  8. 2997048Domain d6jkac1: 6jka C:6-228 [382742]
    Other proteins in same PDB: d6jkaa2, d6jkac2
    automated match to d5ev8c_
    complexed with bqu, bs0, zn

Details for d6jkac1

PDB Entry: 6jka (more details), 2.01 Å

PDB Description: crystal structure of metallo-beta-lactamse, imp-1, in complex with a thiazole-bearing inhibitor
PDB Compounds: (C:) Metallo-beta-lactamase type 2

SCOPe Domain Sequences for d6jkac1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jkac1 d.157.1.1 (C:6-228) automated matches {Serratia marcescens [TaxId: 615]}
eslpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvt
wfvergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgv
nywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksak
llkskygkaklvvpshsevgdasllkltleqavkglneskkps

SCOPe Domain Coordinates for d6jkac1:

Click to download the PDB-style file with coordinates for d6jkac1.
(The format of our PDB-style files is described here.)

Timeline for d6jkac1: