Lineage for d1qqda2 (1qqd A:2-181)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856282Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 856283Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 856284Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 856331Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 856540Species Human (Homo sapiens), HLA-CW4 [TaxId:9606] [54478] (2 PDB entries)
  8. 856541Domain d1qqda2: 1qqd A:2-181 [38274]
    Other proteins in same PDB: d1qqda1, d1qqdb_

Details for d1qqda2

PDB Entry: 1qqd (more details), 2.7 Å

PDB Description: crystal structure of hla-cw4, a ligand for the kir2d natural killer cell inhibitory receptor
PDB Compounds: (A:) histocompatibility leukocyte antigen (hla)-cw4 (heavy chain)

SCOP Domain Sequences for d1qqda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qqda2 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-CW4 [TaxId: 9606]}
shsmryfstsvswpgrgeprfiavgyvddtqfvrfdsdaasprgeprepwveqegpeywd
retqkykrqaqadrvnlrklrgyynqsedgshtlqrmfgcdlgpdgrllrgynqfaydgk
dyialnedlrswtaadtaaqitqrkweaareaeqrraylegtcvewlrrylengketlqr

SCOP Domain Coordinates for d1qqda2:

Click to download the PDB-style file with coordinates for d1qqda2.
(The format of our PDB-style files is described here.)

Timeline for d1qqda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qqda1
View in 3D
Domains from other chains:
(mouse over for more information)
d1qqdb_