Lineage for d1efxa2 (1efx A:1-181)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 600225Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 600226Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 600227Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 600255Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)
  7. 600364Species Human (Homo sapiens), HLA-CW3 [TaxId:9606] [54477] (1 PDB entry)
  8. 600365Domain d1efxa2: 1efx A:1-181 [38273]
    Other proteins in same PDB: d1efxa1, d1efxb_, d1efxd1, d1efxd2, d1efxe1, d1efxe2

Details for d1efxa2

PDB Entry: 1efx (more details), 3 Å

PDB Description: structure of a complex between the human natural killer cell receptor kir2dl2 and a class i mhc ligand hla-cw3

SCOP Domain Sequences for d1efxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efxa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-CW3}
gshsmryfytavsrpgrgephfiavgyvddtqfvrfdsdaasprgeprapwveqegpeyw
dretqkykrqaqtdrvslrnlrgyynqseagshiiqrmygcdvgpdgrllrgydqyaydg
kdyialnedlrswtaadtaaqitqrkweaareaeqlrayleglcvewlrrylkngketlq
r

SCOP Domain Coordinates for d1efxa2:

Click to download the PDB-style file with coordinates for d1efxa2.
(The format of our PDB-style files is described here.)

Timeline for d1efxa2: