Lineage for d6qv8a1 (6qv8 A:2-90)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303207Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2303511Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2303798Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2303799Protein automated matches [226859] (38 species)
    not a true protein
  7. 2304022Species Staphylococcus aureus [TaxId:1280] [346685] (6 PDB entries)
  8. 2304023Domain d6qv8a1: 6qv8 A:2-90 [382720]
    Other proteins in same PDB: d6qv8a2, d6qv8b2
    automated match to d2awpa1
    complexed with mn; mutant

Details for d6qv8a1

PDB Entry: 6qv8 (more details), 1.5 Å

PDB Description: staphylococcus aureus superoxide dismutase sodm double mutant
PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d6qv8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qv8a1 a.2.11.0 (A:2-90) automated matches {Staphylococcus aureus [TaxId: 1280]}
afklpnlpyaydalepyidqrtmefhhdkhhntyvtklnatvegtelehqsladmianld
kvpeamrmsvrnnggghfnhslfweilsp

SCOPe Domain Coordinates for d6qv8a1:

Click to download the PDB-style file with coordinates for d6qv8a1.
(The format of our PDB-style files is described here.)

Timeline for d6qv8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6qv8a2