Class a: All alpha proteins [46456] (290 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
Protein automated matches [226859] (39 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [346685] (6 PDB entries) |
Domain d6qv8a1: 6qv8 A:2-90 [382720] Other proteins in same PDB: d6qv8a2, d6qv8b2 automated match to d2awpa1 complexed with mn; mutant |
PDB Entry: 6qv8 (more details), 1.5 Å
SCOPe Domain Sequences for d6qv8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qv8a1 a.2.11.0 (A:2-90) automated matches {Staphylococcus aureus [TaxId: 1280]} afklpnlpyaydalepyidqrtmefhhdkhhntyvtklnatvegtelehqsladmianld kvpeamrmsvrnnggghfnhslfweilsp
Timeline for d6qv8a1: