SCOPe 2.07: Domain d1e28a2: 1e28 A:1-181

Lineage for d1e28a2 (1e28 A:1-181)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-B51 [TaxId:9606] [54476] (3 PDB entries)

8. Domain d1e28a2: 1e28 A:1-181 [38272]
   Other proteins in same PDB: d1e28a1, d1e28b_

Details for d1e28a2

PDB Entry: 1e28, 3 Å

PDB Description: nonstandard peptide binding of hla-b*5101 complexed with hiv immunodominant epitope km2(taftipsi)

PDB Compounds: (A:) hla class I histocompatibility antigen heavy chain

SCOPe Domain Sequences for d1e28a2:

Sequence; same for both SEQRES and ATOM records:

>d1e28a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B51 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprppwieqegpeyw
drntqifktntqtyrenlrialryynqseagshtwqtmygcdvgpdgrllrghnqyaydg
kdyialnedlsswtaadtaaqitqrkweaareaeqlrayleglcvewlrrhlengketlq
r

Timeline for d1e28a2:

• d1e28a2 first appeared (with stable ids) in SCOP 1.55
  
• d1e28a2 appears in SCOPe 2.06
  
• d1e28a2 appears in the current release, SCOPe 2.08