Lineage for d1e28a2 (1e28 A:1-181)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31165Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 31166Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 31167Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 31179Protein MHC class I, alpha-1 and alpha-2 domains [54468] (18 species)
  7. 31229Species Human (Homo sapiens), HLA-B*5101 [TaxId:9606] [54476] (2 PDB entries)
  8. 31231Domain d1e28a2: 1e28 A:1-181 [38272]
    Other proteins in same PDB: d1e28a1, d1e28b1

Details for d1e28a2

PDB Entry: 1e28 (more details), 3 Å

PDB Description: nonstandard peptide binding of hla-b*5101 complexed with hiv immunodominant epitope km2(taftipsi)

SCOP Domain Sequences for d1e28a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e28a2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B*5101}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprppwieqegpeyw
drntqifktntqtyrenlrialryynqseagshtwqtmygcdvgpdgrllrghnqyaydg
kdyialnedlsswtaadtaaqitqrkweaareaeqlrayleglcvewlrrhlengketlq
r

SCOP Domain Coordinates for d1e28a2:

Click to download the PDB-style file with coordinates for d1e28a2.
(The format of our PDB-style files is described here.)

Timeline for d1e28a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e28a1
View in 3D
Domains from other chains:
(mouse over for more information)
d1e28b1