Lineage for d1a9bd2 (1a9b D:1-181)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719393Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)
  7. 719526Species Human (Homo sapiens), HLA-B35 [TaxId:9606] [54475] (5 PDB entries)
  8. 719531Domain d1a9bd2: 1a9b D:1-181 [38270]
    Other proteins in same PDB: d1a9ba1, d1a9bb_, d1a9bd1, d1a9be_

Details for d1a9bd2

PDB Entry: 1a9b (more details), 3.2 Å

PDB Description: decamer-like conformation of a nano-peptide bound to hla-b3501 due to nonstandard positioning of the c-terminus
PDB Compounds: (D:) hla class I histocompatibility antigen, b-35 b*3501 (alpha chain)

SCOP Domain Sequences for d1a9bd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a9bd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B35 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw
drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq
r

SCOP Domain Coordinates for d1a9bd2:

Click to download the PDB-style file with coordinates for d1a9bd2.
(The format of our PDB-style files is described here.)

Timeline for d1a9bd2: