![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species) |
![]() | Species Human (Homo sapiens), HLA-B35 [TaxId:9606] [54475] (5 PDB entries) Uniprot P30685 25-300 |
![]() | Domain d1a9ba2: 1a9b A:1-181 [38269] Other proteins in same PDB: d1a9ba1, d1a9bb_, d1a9bd1, d1a9be_ |
PDB Entry: 1a9b (more details), 3.2 Å
SCOP Domain Sequences for d1a9ba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a9ba2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B35 [TaxId: 9606]} gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq r
Timeline for d1a9ba2:
![]() Domains from other chains: (mouse over for more information) d1a9bb_, d1a9bd1, d1a9bd2, d1a9be_ |