SCOPe 2.07: Domain d6r73a_: 6r73 A:

Lineage for d6r73a_ (6r73 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein automated matches [190079] (12 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [189349] (72 PDB entries)

8. Domain d6r73a_: 6r73 A: [382684]
   automated match to d5ev8c_
   complexed with lmp, zn

Details for d6r73a_

PDB Entry: 6r73, 2.3 Å

PDB Description: structure of imp-13 metallo-beta-lactamase complexed with hydrolysed meropenem

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d6r73a_:

Sequence; same for both SEQRES and ATOM records:

>d6r73a_ d.157.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
lpdlkiekleegvfvhtsfeevngwgvvtkhglvvlvntdaylidtpftatdteklvnwf
vergyeikgtisshfhsdstggiewlnsqsiptyaseltnellkksgkvqakysfsevsy
wlvknkievfypgpghtqdnlvvwlpeskilfggcfikphglgnlgdanleawpksakil
mskygkaklvvsshsekgdaslmkrtweqalkglke

Timeline for d6r73a_:

• d6r73a_ is new in SCOPe 2.07-stable
  
• d6r73a_ appears in the current release, SCOPe 2.08