![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
![]() | Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
![]() | Protein automated matches [226860] (37 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [346687] (6 PDB entries) |
![]() | Domain d6qv9b2: 6qv9 B:92-198 [382678] Other proteins in same PDB: d6qv9a1, d6qv9b1 automated match to d2rcva2 complexed with mn; mutant |
PDB Entry: 6qv9 (more details), 1.8 Å
SCOPe Domain Sequences for d6qv9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qv9b2 d.44.1.0 (B:92-198) automated matches {Staphylococcus aureus [TaxId: 1280]} seekgtvvekikeqwgsleefkkefadkaaarfgsgwawlvvnngqleivttpnqdnplt egktpillfdvwehayylkyqnkrpdyigafwnvvnwekvdelynat
Timeline for d6qv9b2: