SCOPe 2.08: Domain d6qv9b2: 6qv9 B:92-198

Lineage for d6qv9b2 (6qv9 B:92-198)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (38 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [346687] (6 PDB entries)

8. Domain d6qv9b2: 6qv9 B:92-198 [382678]
   Other proteins in same PDB: d6qv9a1, d6qv9b1
   automated match to d2rcva2
   complexed with mn; mutant

Details for d6qv9b2

PDB Entry: 6qv9, 1.8 Å

PDB Description: staphylococcus aureus superoxide dismutase soda double mutant

PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d6qv9b2:

Sequence; same for both SEQRES and ATOM records:

>d6qv9b2 d.44.1.0 (B:92-198) automated matches {Staphylococcus aureus [TaxId: 1280]}
seekgtvvekikeqwgsleefkkefadkaaarfgsgwawlvvnngqleivttpnqdnplt
egktpillfdvwehayylkyqnkrpdyigafwnvvnwekvdelynat

Timeline for d6qv9b2:

• d6qv9b2 first appeared in SCOPe 2.07