![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) ![]() |
![]() | Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) |
![]() | Protein automated matches [190079] (12 species) not a true protein |
![]() | Species Serratia marcescens [TaxId:615] [186800] (10 PDB entries) |
![]() | Domain d6jkab_: 6jka B: [382656] Other proteins in same PDB: d6jkaa2, d6jkac2 automated match to d5ev8c_ complexed with bqu, bs0, zn |
PDB Entry: 6jka (more details), 2.01 Å
SCOPe Domain Sequences for d6jkab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jkab_ d.157.1.1 (B:) automated matches {Serratia marcescens [TaxId: 615]} slpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtw fvergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvn ywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakl lkskygkaklvvpshsevgdasllkltleqavkglneskk
Timeline for d6jkab_: