Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (60 species) not a true protein |
Species Leptolyngbya sp. [TaxId:1080068] [382615] (1 PDB entry) |
Domain d6lkpf_: 6lkp F: [382653] automated match to d5hjfa_ complexed with fe, zn |
PDB Entry: 6lkp (more details), 2.9 Å
SCOPe Domain Sequences for d6lkpf_:
Sequence, based on SEQRES records: (download)
>d6lkpf_ a.25.1.0 (F:) automated matches {Leptolyngbya sp. [TaxId: 1080068]} npiglemnvttavcegfnivlasfqalylqyqkhhfvvegsefyqlheffsesydevqgh vheigerlnglggvpvasfsklaelccftpepdgvfscramvehdlsaeqeiikvirrqa gqaeslgdratrhlyekillesedrafhlshflahds
>d6lkpf_ a.25.1.0 (F:) automated matches {Leptolyngbya sp. [TaxId: 1080068]} npiglemnvttavcegfnivlasfqalylqyqkhhfvvegsefyqlheffsesydevqgh vheigerlnglggvpvklaelccftpepdgvfscramvehdlsaeqeiikvirrqagqae slgdratrhlyekillesedrafhlshflahds
Timeline for d6lkpf_: