Lineage for d6lkpf_ (6lkp F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2704256Species Leptolyngbya sp. [TaxId:1080068] [382615] (1 PDB entry)
  8. 2704262Domain d6lkpf_: 6lkp F: [382653]
    automated match to d5hjfa_
    complexed with fe, zn

Details for d6lkpf_

PDB Entry: 6lkp (more details), 2.9 Å

PDB Description: crystal structure of dps1 from the thermophilic non-heterocystous filamentous cyanobacterium thermoleptolyngbya sp. o-77
PDB Compounds: (F:) DNA protection during starvation protein

SCOPe Domain Sequences for d6lkpf_:

Sequence, based on SEQRES records: (download)

>d6lkpf_ a.25.1.0 (F:) automated matches {Leptolyngbya sp. [TaxId: 1080068]}
npiglemnvttavcegfnivlasfqalylqyqkhhfvvegsefyqlheffsesydevqgh
vheigerlnglggvpvasfsklaelccftpepdgvfscramvehdlsaeqeiikvirrqa
gqaeslgdratrhlyekillesedrafhlshflahds

Sequence, based on observed residues (ATOM records): (download)

>d6lkpf_ a.25.1.0 (F:) automated matches {Leptolyngbya sp. [TaxId: 1080068]}
npiglemnvttavcegfnivlasfqalylqyqkhhfvvegsefyqlheffsesydevqgh
vheigerlnglggvpvklaelccftpepdgvfscramvehdlsaeqeiikvirrqagqae
slgdratrhlyekillesedrafhlshflahds

SCOPe Domain Coordinates for d6lkpf_:

Click to download the PDB-style file with coordinates for d6lkpf_.
(The format of our PDB-style files is described here.)

Timeline for d6lkpf_: