Lineage for d1a1oa2 (1a1o A:1-181)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1897285Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 1897508Species Human (Homo sapiens), HLA-B53 [TaxId:9606] [54474] (23 PDB entries)
  8. 1897527Domain d1a1oa2: 1a1o A:1-181 [38265]
    Other proteins in same PDB: d1a1oa1, d1a1ob_

Details for d1a1oa2

PDB Entry: 1a1o (more details), 2.3 Å

PDB Description: mhc class i molecule b*5301 complexed with peptide ls6 (kpivqydnf) from the malaria parasite p. falciparum
PDB Compounds: (A:) HLA class I histocompatibility antigen, BW-53 B*5301 alpha chain

SCOPe Domain Sequences for d1a1oa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a1oa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B53 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprppwieqegpeyw
drntqifktntqtyrenlrialryynqseagshiiqrmygcdlgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq
r

SCOPe Domain Coordinates for d1a1oa2:

Click to download the PDB-style file with coordinates for d1a1oa2.
(The format of our PDB-style files is described here.)

Timeline for d1a1oa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a1oa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1a1ob_