| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.107: DHH phosphoesterases [64181] (1 superfamily) consists of two non-similar domains Domain 1 has parallel sheet of 6 strands, order 321456 Domain 2 has mixed sheet of 5 strands, order 12345; strands 1 & 4 are antiparallel to the rest |
Superfamily c.107.1: DHH phosphoesterases [64182] (3 families) ![]() constituent families have similar domain organization with variable interdomain linker and spatial arrangement of the domains |
| Family c.107.1.0: automated matches [191432] (1 protein) not a true family |
| Protein automated matches [190622] (2 species) not a true protein |
| Species Shewanella sp. [TaxId:912551] [382630] (2 PDB entries) |
| Domain d6ll8b_: 6ll8 B: [382648] automated match to d1k23a_ complexed with 2pn, ca, epe, f, gol, mg |
PDB Entry: 6ll8 (more details), 1.3 Å
SCOPe Domain Sequences for d6ll8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ll8b_ c.107.1.0 (B:) automated matches {Shewanella sp. [TaxId: 912551]}
smyvvghkipdsdsicgaialaylknqigepaiaarlgelspetafilekfgfeapeykt
syageevyivdhseitqapddiaqativgivdhhklgdlttstplecwirpvgcsntvik
mmydfyqvkipaniagimmcailsdtvifksptcttadircvealaeiagvedfkevgmd
mfkvksavegtpardlvmrdfkdfnmngnlvgigqlevidlavfddikadleadiaklkv
egnrhsvlllltdimkegsemlvvsdsadlteraygkptvdgrvwldgvlsrkkqvvpal
qdafqk
Timeline for d6ll8b_: