SCOPe 2.08: Domain d6ll8b_: 6ll8 B:

Lineage for d6ll8b_ (6ll8 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.107: DHH phosphoesterases [64181] (1 superfamily)
   consists of two non-similar domains
   Domain 1 has parallel sheet of 6 strands, order 321456
   Domain 2 has mixed sheet of 5 strands, order 12345; strands 1 & 4 are antiparallel to the rest

4. Superfamily c.107.1: DHH phosphoesterases [64182] (3 families)
   constituent families have similar domain organization with variable interdomain linker and spatial arrangement of the domains

5. Family c.107.1.0: automated matches [191432] (1 protein)
   not a true family

6. Protein automated matches [190622] (2 species)
   not a true protein

7. Species Shewanella sp. [TaxId:912551] [382630] (2 PDB entries)

8. Domain d6ll8b_: 6ll8 B: [382648]
   automated match to d1k23a_
   complexed with 2pn, ca, epe, f, gol, mg

Details for d6ll8b_

PDB Entry: 6ll8, 1.3 Å

PDB Description: type ii inorganic pyrophosphatase (ppase) from the psychrophilic bacterium shewanella sp. as-11, mg-pnp form

PDB Compounds: (B:) inorganic pyrophosphatase

SCOPe Domain Sequences for d6ll8b_:

Sequence; same for both SEQRES and ATOM records:

>d6ll8b_ c.107.1.0 (B:) automated matches {Shewanella sp. [TaxId: 912551]}
smyvvghkipdsdsicgaialaylknqigepaiaarlgelspetafilekfgfeapeykt
syageevyivdhseitqapddiaqativgivdhhklgdlttstplecwirpvgcsntvik
mmydfyqvkipaniagimmcailsdtvifksptcttadircvealaeiagvedfkevgmd
mfkvksavegtpardlvmrdfkdfnmngnlvgigqlevidlavfddikadleadiaklkv
egnrhsvlllltdimkegsemlvvsdsadlteraygkptvdgrvwldgvlsrkkqvvpal
qdafqk

Timeline for d6ll8b_:

• d6ll8b_ first appeared in SCOPe 2.07