Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) |
Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
Protein automated matches [190418] (31 species) not a true protein |
Species Vibrio alginolyticus [TaxId:663] [377335] (3 PDB entries) |
Domain d6lf4d_: 6lf4 D: [382644] automated match to d5ev8c_ complexed with lmp, zn |
PDB Entry: 6lf4 (more details), 2.01 Å
SCOPe Domain Sequences for d6lf4d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6lf4d_ d.157.1.0 (D:) automated matches {Vibrio alginolyticus [TaxId: 663]} gtkelklkklsdnvyqhisykrvepwgligasglvvingteahmidtpwttqgtkqliew ieakgltiksavvthfhedasgdipllndlkiktyatsltnkllklnqkevssdeissnt fefidgvasvfypgaghtednivvwlpnekilfggcfvkslknknlgytgdanisewpns mqkvinrypdaklvvpghgevgdvsllkhtqalalsaaa
Timeline for d6lf4d_: