SCOPe 2.01: Domain d1agea2: 1age A:1-181

Lineage for d1agea2 (1age A:1-181)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)

7. Species Human (Homo sapiens), HLA-B08 [TaxId:9606] [54473] (7 PDB entries)

8. Domain d1agea2: 1age A:1-181 [38264]
   Other proteins in same PDB: d1agea1, d1ageb_
   mutant

Details for d1agea2

PDB Entry: 1age, 2.3 Å

PDB Description: antagonist hiv-1 gag peptides induce structural changes in hla b8-hiv-1 gag peptide (ggkkkyrl-7r mutation)

PDB Compounds: (A:) b*0801

SCOPe Domain Sequences for d1agea2:

Sequence; same for both SEQRES and ATOM records:

>d1agea2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B08 [TaxId: 9606]}
gshsmryfdtamsrpgrgeprfisvgyvddtqfvrfdsdaaspreeprapwieqegpeyw
drntqifktntqtdreslrnlrgyynqseagshtlqsmygcdvgpdgrllrghnqyaydg
kdyialnedlrswtaadtaaqitqrkweaarvaeqdraylegtcvewlrrylengkdtle
r

Timeline for d1agea2:

• d1agea2 first appeared (with stable ids) in SCOP 1.55
  
• d1agea2 appears in SCOP 1.75
  
• d1agea2 appears in SCOPe 2.02
  
• d1agea2 appears in the current release, SCOPe 2.08